HPA010132

KIAA1549L antibody from Sigma-Aldrich
C11orf41, C11orf69, G2, MGC34830
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA010132
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA010132, RRID:AB_1078313
Product name
Anti-C11orf41 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA010132
Antibody type
Polyclonal
Antigen
Putative membrane protein C11orf41
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
PASASKQVRASPSSMDVYDSLTIGDMKKPATTDVF
WSSLSAETGSLSTESIISGLQQQTNYDLNGHTIST
TSWETHLAPTAPPNGLTSAADAIKSQDFKDTAGHS
VTAEGFSIQDLVLGT
Storage
-20C
Provider Type Product Number
- No reagents -