HPA011141

UNC5B antibody from Sigma-Aldrich
p53RDL1, UNC5H2
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011141
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011141, RRID:AB_1858621
Product name
Anti-UNC5B antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011141
Antibody type
Polyclonal
Antigen
Netrin receptor UNC5B precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TQTVLSPSVTCGPTGLLLCRPVILTMPHCAEVSAR
DWIFQLKTQAHQGHWEEVVTLDEETLNTPCYCQLE
PRACHILLDQLGTYVFTGESYSRSAVKRLQLAVFA
PALCTSLEYSLRVYCLEDTPVALKEVLE
Storage
-20C
Provider Type Product Number
- No reagents -