SAB1400578
antibody from MilliporeSigma / Merck KGaA
Targeting: BRWD1
C21orf107, DCAF19, FLJ11315, N143, WDR9
Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- SAB1400578 - Provider product page

- Provider
- MilliporeSigma / Merck KGaA
- Product name
- Anti-BRWD1 antibody produced in mouse
- Antibody type
- Polyclonal
- Antigen
- BRWD1 (NP_001007247.1, a.a. 1-120) full-length human protein.
- Description
- IgG fraction of antiserum
- Reactivity
- Human
- Antigen sequence
MAEPSSARRPVPLIESELYFLIARYLSAGPCRRAA
QVLVQELEQYQLLPKRLDWEGNEHNRSYEELVLSN
KHVAPDHLLQICQRIGPMLDKEIPPSISRVTSLLG
AGRQSLLRTAKGTLI (without GST)- Storage
- -20C
No comments: Submit comment
No validations: Submit validation data