HPA017232

CDH23 antibody from Sigma-Aldrich
CDHR23, DFNB12, USH1D
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA017232
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA017232, RRID:AB_1845903
Product name
Anti-CDH23 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA017232
Antibody type
Polyclonal
Antigen
Cadherin-23 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
YFVVDIVARDLAGHNDTAIIGIYILRDDQRVKIVI
NEIPDRVRGFEEEFIHLLSNITGAIVNTDNVQFHV
DKKGRVNFAQTELLIHVVNRDTNRILDVDRVIQMI
DENKEQLRNLFRNYNVLD
Storage
-20C
Provider Type Product Number
- No reagents -