Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA017232 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA017232, RRID:AB_1845903
- Product name
- Anti-CDH23
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
YFVVDIVARDLAGHNDTAIIGIYILRDDQRVKIVI
NEIPDRVRGFEEEFIHLLSNITGAIVNTDNVQFHV
DKKGRVNFAQTELLIHVVNRDTNRILDVDRVIQMI
DENKEQLRNLFRNYNVLD- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references Transient interactions drive the lateral clustering of cadherin-23 on membrane
The strong propensity of Cadherin‐23 for aggregation inhibits cell migration
Grxcr1 Promotes Hair Bundle Development by Destabilizing the Physical Interaction between Harmonin and Sans Usher Syndrome Proteins
Srinivas C, Singaraju G, Kaur V, Das S, Ghosh S, Sagar A, Kumar A, Bhatia T, Rakshit S
Communications Biology 2023;6(1)
Communications Biology 2023;6(1)
The strong propensity of Cadherin‐23 for aggregation inhibits cell migration
Sannigrahi M, Srinivas C, Deokate N, Rakshit S
Molecular Oncology 2019;13(5):1092-1109
Molecular Oncology 2019;13(5):1092-1109
Grxcr1 Promotes Hair Bundle Development by Destabilizing the Physical Interaction between Harmonin and Sans Usher Syndrome Proteins
Blanco-Sánchez B, Clément A, Fierro J, Stednitz S, Phillips J, Wegner J, Panlilio J, Peirce J, Washbourne P, Westerfield M
Cell Reports 2018;25(5):1281-1291.e4
Cell Reports 2018;25(5):1281-1291.e4
No comments: Submit comment
No validations: Submit validation data