HPA017232

CDH23 antibody from Atlas Antibodies
CDHR23, DFNB12, USH1D
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA017232
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA017232, RRID:AB_1845903
Product name
Anti-CDH23
Provider product page
Atlas Antibodies - HPA017232
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
YFVVDIVARDLAGHNDTAIIGIYILRDDQRVKIVI
NEIPDRVRGFEEEFIHLLSNITGAIVNTDNVQFHV
DKKGRVNFAQTELLIHVVNRDTNRILDVDRVIQMI
DENKEQLRNLFRNYNVLD
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -