Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00057511-M01 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00057511-M01, RRID:AB_565599
- Product name
- COG6 monoclonal antibody (M01), clone 5B5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant COG6.
- Antigen sequence
QQHKPEQGSLANMPNLDSVTLKAAMVQFDRYLSAP
DNLLIPQLNFLLSATVKEQIVKQSTELVCRAYGEV
YAAVMNPINEYKDPENILHRSPQQVQTLLS- Isotype
- IgG
- Antibody clone number
- 5B5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references A genome-wide association study of psoriasis and psoriatic arthritis identifies new disease loci.
Liu Y, Helms C, Liao W, Zaba LC, Duan S, Gardner J, Wise C, Miner A, Malloy MJ, Pullinger CR, Kane JP, Saccone S, Worthington J, Bruce I, Kwok PY, Menter A, Krueger J, Barton A, Saccone NL, Bowcock AM
PLoS genetics 2008 Mar 28;4(3):e1000041
PLoS genetics 2008 Mar 28;4(3):e1000041
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- COG6 monoclonal antibody (M01), clone 5B5 Western Blot analysis of COG6 expression in A-431 ( Cat # L015V1 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged COG6 is approximately 1ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
