Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN501688 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Forkhead Box A1 (FOXA1) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-FOXA1 antibody: synthetic peptide directed towards the N terminal of human FOXA1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Chicken/Avian, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
LGTVKMEGHETSDWNSYYADTQEAYSSVPVSNMNS
GLGSM NSMNTYMTMN- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Insight into mechanism of in vitro insulin secretion increase induced by antipsychotic clozapine: role of FOXA1 and mitochondrial citrate carrier.
FoxA1 translates epigenetic signatures into enhancer-driven lineage-specific transcription.
Menga A, Infantino V, Iacobazzi F, Convertini P, Palmieri F, Iacobazzi V
European neuropsychopharmacology : the journal of the European College of Neuropsychopharmacology 2013 Aug;23(8):978-87
European neuropsychopharmacology : the journal of the European College of Neuropsychopharmacology 2013 Aug;23(8):978-87
FoxA1 translates epigenetic signatures into enhancer-driven lineage-specific transcription.
Lupien M, Eeckhoute J, Meyer CA, Wang Q, Zhang Y, Li W, Carroll JS, Liu XS, Brown M
Cell 2008 Mar 21;132(6):958-70
Cell 2008 Mar 21;132(6):958-70
No comments: Submit comment
No validations: Submit validation data