Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182624 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Forkhead Box A1 (FOXA1) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-FOXA1 antibody: synthetic peptide directed towards the C terminal of human FOXA1
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Xenopus, Zebrafish
- Host
- Rabbit
- Antigen sequence
SFNHPFSINNLMSSSEQQHKLDFKAYEQALQYSPY
GSTLP ASLPLGSASV- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references BRCA1 and FOXA1 proteins coregulate the expression of the cell cycle-dependent kinase inhibitor p27(Kip1).
Williamson EA, Wolf I, O'Kelly J, Bose S, Tanosaki S, Koeffler HP
Oncogene 2006 Mar 2;25(9):1391-9
Oncogene 2006 Mar 2;25(9):1391-9
No comments: Submit comment
Supportive validation
- Submitted by
- antibodies-online (provider)
- Main image
- Experimental details
- WB Suggested Anti-FOXA1 Antibody Positive Control: Lane 1:241 μg MCF7 cell lysates Lane 2: 041 μg MCF7 cell lysates Lane 3: 041 μg MCF7 cell lysates Lane 4: 041 μg MCF7 cell lysates Lane 5: 041 μg MCF7 with FoxA1 knockdown Lane 6: 041 μg MCF7 with FoxA1 knockdown Primary Antibody Dilution: 1:0000Secondary Antibody: Anti-rabbit-HRP Secondry Antibody Dilution: 1:0000Submitted by: Fu, Xiaoyong, Baylor College of MedicineFOXA1 is supported by BioGPS gene expression data to be expressed in MCF7