Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN182655 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Forkhead Box P3 (FOXP3) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-FOXP3 antibody: synthetic peptide directed towards the N terminal of human FOXP3
- Description
- Protein A purified
- Reactivity
- Human, Mouse, Rat, Bovine, Canine, Porcine
- Host
- Rabbit
- Antigen sequence
PHFMHQLSTVDAHARTPVLQVHPLESPAMISLTPP
TTATG VFSLKARPGL- Epitope
- N-Term
- Vial size
- 100 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Naïve rat umbilical cord matrix stem cells significantly attenuate mammary tumor growth through modulation of endogenous immune responses.
CD25+CD4+ T cells in human cord blood: an immunoregulatory subset with naive phenotype and specific expression of forkhead box p3 (Foxp3) gene.
Kawabata A, Ohta N, Seiler G, Pyle MM, Ishiguro S, Zhang YQ, Becker KG, Troyer D, Tamura M
Cytotherapy 2013 May;15(5):586-97
Cytotherapy 2013 May;15(5):586-97
CD25+CD4+ T cells in human cord blood: an immunoregulatory subset with naive phenotype and specific expression of forkhead box p3 (Foxp3) gene.
Takahata Y, Nomura A, Takada H, Ohga S, Furuno K, Hikino S, Nakayama H, Sakaguchi S, Hara T
Experimental hematology 2004 Jul;32(7):622-9
Experimental hematology 2004 Jul;32(7):622-9
No comments: Submit comment
No validations: Submit validation data