H00028227-M14

PPP2R3B antibody from Abnova Corporation
PPP2R3L, PPP2R3LY, PR48, PR70

Antibody data

Product number
H00028227-M14
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00028227-M14, RRID:AB_1237827
Product name
PPP2R3B monoclonal antibody (M14), clone 1F4
Provider product page
Abnova Corporation - H00028227-M14
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant PPP2R3B.
Antigen sequence
MDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPF
QDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFD
TFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEK
YAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLS
ALRSPLAQRPFFEAPSPLGAVDLYEYACGDEDLES
L
Isotype
IgG
Antibody clone number
1F4
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -