H00028227-B02P

PPP2R3B antibody from Abnova Corporation
PPP2R3L, PPP2R3LY, PR48, PR70

Antibody data

Product number
H00028227-B02P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00028227-B02P, RRID:AB_1579034
Product name
PPP2R3B purified MaxPab mouse polyclonal antibody (B02P)
Provider product page
Abnova Corporation - H00028227-B02P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human PPP2R3B protein.
Antigen sequence
MDLDGDGALSMFELEYFYEEQCRRLDSMAIEALPF
QDCLCQMLDLVKPRTEGKITLQDLKRCKLANVFFD
TFFNIEKYLDHEQKEQISLLRDGDSGGPELSDWEK
YAAEEYDILVAEETAGEPWEDGFEAELSPVEQKLS
ALRSPLAQRPFFEAPSPLGAVDLYEYACGDEDLEP
L
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -