SAB1400576

PELO antibody from Sigma-Aldrich
ELISA
Recommended by provider

Antibody data

Product number
SAB1400576
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1400576, RRID:AB_1855187
Product name
Anti-PELO antibody produced in mouse
Provider product page
Sigma-Aldrich - SAB1400576
Antibody type
Polyclonal
Antigen
PELO (AAH05889, a.a. 1-385) full-length human protein.
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
MKLVRKNIEKDNAGQVTLVPEEPEDMWHTYNLVQV
GDSLRASTIRKVQTESSTGSVGSNRVRTTLTLCVE
AIDFDSQACQLRVKGTNIQENEYVKMGAYHTIELE
PNRQFTLAKKQWDSVVLERIEQACDPAWSADVAAV
VMQEGLAHICLVTPSMTLTRAKVEVNIPRKRKGNC
SQHDRALERFYEQVVQAIQRHIHFDVVKCILVASP
GFVREQFCDYMFQQAVKTDNKLLLENRSKFLQVHA
SSGHKYSLKEALCDPTVASRLSDTKAAGEVKALDD
FYKMLQHEPDRAFYGLKQVEKANEAMAIDTLLISD
ELFRHQDVATRSRYVRLVDSVKENAGTVRIFSSLH
VSGEQLSQLTGVAAILRFPVPELSDQEGDSSSEED
(without GST)
Storage
-20C
Provider Type Product Number
- No reagents -