Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00003823-M01 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00003823-M01, RRID:AB_489921
- Product name
- KLRC3 monoclonal antibody (M01), clone 3D5
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant KLRC3.
- Antigen sequence
GKERRTWEESLQACASKNSSSLLSIDNEEEMKFLA
SILPSSWIGVFRNSSHHPWVTINGLAFKHEIKDSD
HAERNCAMLHVRGLISDQCGSSRIIRRGFIMLTRL
VLNS- Isotype
- IgG
- Antibody clone number
- 3D5
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Human NKG2E is expressed and forms an intracytoplasmic complex with CD94 and DAP12.
Orbelyan GA, Tang F, Sally B, Solus J, Meresse B, Ciszewski C, Grenier JC, Barreiro LB, Lanier LL, Jabri B
Journal of immunology (Baltimore, Md. : 1950) 2014 Jul 15;193(2):610-6
Journal of immunology (Baltimore, Md. : 1950) 2014 Jul 15;193(2):610-6
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged KLRC3 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol