Explore
Validate
Learn
Western blotAntibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00055276-M05 - Provider product page
- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00055276-M05, RRID:AB_566074
- Product name
- PGM2 monoclonal antibody (M05), clone 1A3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant PGM2.
- Antigen sequence
MAAPEGSGLGEDARLDQETAQWLRWDKNSLTLEAV
KRLIAEGNKEELRKCFGARMEFGTAGLRAAMGPGI
SRMNDLTIIQTTQGFCRYLE- Isotype
- IgG
- Antibody clone number
- 1A3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references The functional landscape of Hsp27 reveals new cellular processes such as DNA repair and alternative splicing and proposes novel anticancer targets.
Katsogiannou M, Andrieu C, Baylot V, Baudot A, Dusetti NJ, Gayet O, Finetti P, Garrido C, Birnbaum D, Bertucci F, Brun C, Rocchi P
Molecular & cellular proteomics : MCP 2014 Dec;13(12):3585-601
Molecular & cellular proteomics : MCP 2014 Dec;13(12):3585-601
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- PGM2 monoclonal antibody (M05), clone 1A3 Western Blot analysis of PGM2 expression in Hela S3 NE ( Cat # L013V3 ).
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Detection limit for recombinant GST tagged PGM2 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
