Antibody data
- Antibody Data
- Antigen structure
- References [0]
- Comments [0]
- Validations
- Immunocytochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00027043-M06 - Provider product page
- Provider
- Abnova Corporation
- Product name
- PELP1 monoclonal antibody (M06), clone 4F3
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a full length recombinant PELP1.
- Antigen sequence
LNSWSIGRDSLSPGQERPYSTVRTKVYAILELWVQ
VCGASAGMLQGGASGEALLTHLLSDISPPADALKL
RSPR- Isotype
- IgG
- Antibody clone number
- 4F3
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image
- Experimental details
- Immunofluorescence of monoclonal antibody to PELP1 on HeLa cell . [antibody concentration 10 ug/ml]
- Validation comment
- Immunofluorescence
- Protocol
- Protocol