Antibody data

Product number
H00081855-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00081855-M01, RRID:AB_1204972
Product name
SFXN3 monoclonal antibody (M01), clone 4A3
Provider product page
Abnova Corporation - H00081855-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SFXN3.
Antigen sequence
MESKMGELPLDINIQEPRWDQSTFLGRARHFFTVT
DPRNLLLSGAQLEASRNIVQNYRAGVVTPGITEDQ
LWRAKYVYDSAFHPDTGEKVVLIGRMSAQV
Isotype
IgG
Antibody clone number
4A3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -