HPA008028

SFXN3 antibody from Sigma-Aldrich
SFX3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA008028
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA008028, RRID:AB_1079938
Product name
Anti-SFXN3 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA008028
Antibody type
Polyclonal
Antigen
Sideroflexin-3 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
ESKMGELPLDINIQEPRWDQSTFLGRARHFFTVTD
PRNLLLSGAQLEASRNIVQNYRAGVVTPGITEDQL
WRAKYVYDSAFHPDTGEKVVLIGRMSAQVPMN
Storage
-20C
Provider Type Product Number
- No reagents -