SAB1400831

CLEC14A antibody from Sigma-Aldrich
C14orf27
ELISA
Recommended by provider

Antibody data

Product number
SAB1400831
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB1400831, RRID:AB_1846910
Product name
Anti-CLEC14A antibody produced in mouse
Provider product page
Sigma-Aldrich - SAB1400831
Antibody type
Polyclonal
Antigen
CLEC14A (NP_778230, a.a. 1-490) full-length human protein.
Description
IgG fraction of antiserum
Reactivity
Human
Antigen sequence
MRPAFALCLLWQALWPGPGGGEHPTADRAGCSASG
ACYSLHHATMKRQAAEEACILRGGALSTVRAGAEL
RAVLALLRAGPGPGGGSKDLLFWVALERRRSHCTL
ENEPLRGFSWLSSDPGGLESDTLQWVEEPQRSCTA
RRCAVLQATGGVEPAGWKEMRCHLRANGYLCKYQF
EVLCPAPRPGAASNLSYRAPFQLHSAALDFSPPGT
EVSALCRGQLPISVTCIADEIGARWDKLSGDVLCP
CPGRYLRAGKCAELPNCLDDLGGFACECATGFELG
KDGRSCVTSGEGQPTLGGTGVPTRRPPATATSPVP
QRTWPIRVDEKLGETPLVPEQDNSVTSIPEIPRWG
SQSTMSTLQMSLQAESKATITPSGSVISKFNSTTS
SATPQAFDSSSAVVFIFVSTAVVVLVILTMTVLGL
VKLCFHESPSSQPRKESMGPPGLESDPEPAALGSS
Storage
-20C
Provider Type Product Number
- No reagents -