H00006473-B01P

SHOX antibody from Abnova Corporation
GCFX, PHOG, SHOXY, SS

Antibody data

Product number
H00006473-B01P
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00006473-B01P, RRID:AB_1580595
Product name
SHOX purified MaxPab mouse polyclonal antibody (B01P)
Provider product page
Abnova Corporation - H00006473-B01P
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human SHOX protein.
Antigen sequence
MEELTAFVSKSFDQKSKDGNGGGGGGGGKKDSITY
REVLESGLARSRELGTSDSSLQDITEGGGHCPVHL
FKDHVDNDKEKLKEFGTARVAEGIYECKEKREDVK
SEDEDGQTKLKQRRSRTNFTLEQLNELERLFDETH
YPDAFMREELSQRLGLSEARVQVWFQNRRAKCRKQ
ENQMHKGVILGTANHLDACRVAPYVNMGALRMPFQ
QMEFCSCRPGWSIMA
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -