Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN502585 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Acyl-CoA Binding Domain Containing 5 (ACBD5) (C-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-ACBD5 antibody: synthetic peptide directed towards the C terminal of human ACBD5
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian, Xenopus
- Host
- Rabbit
- Antigen sequence
VRRGRGHRMQHLSEGTKGRQVGSGGDGERWGSDRG
SRGSL NEQIALVLMR- Epitope
- C-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Characterization of size-fractionated cDNA libraries generated by the in vitro recombination-assisted method.
Ohara O, Nagase T, Mitsui G, Kohga H, Kikuno R, Hiraoka S, Takahashi Y, Kitajima S, Saga Y, Koseki H
DNA research : an international journal for rapid publication of reports on genes and genomes 2002 Apr 30;9(2):47-57
DNA research : an international journal for rapid publication of reports on genes and genomes 2002 Apr 30;9(2):47-57
No comments: Submit comment
No validations: Submit validation data