HPA011861

ACBD5 antibody from Atlas Antibodies
DKFZp434A2417, KIAA1996
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA011861
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA011861, RRID:AB_1233403
Product name
Anti-ACBD5
Provider product page
Atlas Antibodies - HPA011861
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
IQVPPGNGNIGNMQVVAVEGKGEVKHGGEDGRNNS
GAPHREKRGGETDEFSNVRRGRGHRMQHLSEGTKG
RQVGSGGDGERWGSDRGSRGSLNEQIALVLMRLQE
DMQNVLQRLQKLETLTALQAKSSTSTLQTAPQPTS
QRPSWWPF
Isotype
IgG
Vial size
100 µl
Storage
Store at +4¡C for short term storage. Long time storage is recommended at -20¡C.
Provider Type Product Number
- No reagents -