HPA011861

ACBD5 antibody from Sigma-Aldrich
DKFZp434A2417, KIAA1996
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011861
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011861, RRID:AB_1844493
Product name
Anti-ACBD5 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011861
Antibody type
Polyclonal
Antigen
Acyl-CoA-binding domain-containing protein 5 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
IQVPPGNGNIGNMQVVAVEGKGEVKHGGEDGRNNS
GAPHREKRGGETDEFSNVRRGRGHRMQHLSEGTKG
RQVGSGGDGERWGSDRGSRGSLNEQIALVLMRLQE
DMQNVLQRLQKLETLTALQAKSSTSTLQTAPQPTS
QRPSWWPF
Storage
-20C
Provider Type Product Number
- No reagents -