HPA012145

ACBD5 antibody from Atlas Antibodies
DKFZp434A2417, KIAA1996
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA012145
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA012145, RRID:AB_1233404
Product name
Anti-ACBD5
Provider product page
Atlas Antibodies - HPA012145
Antibody type
Polyclonal
Description
Affinity purified using the PrEST antigen as affinity ligand
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
AQEEVKGAEQSDNDKKMMKKSADHKNLEVIVTNGY
DKDGFVQDIQNDIHASSSLNGRSTEEVKPIDENLG
QTGKSAVCIHQDINDDHVEDVTGIQHLTSDSDSEV
YCDSMEQFGQEESLDSFTSNNGPFQYYLGGHSSQP
M
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -