Antibody data
- Antibody Data
- Antigen structure
- References [2]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00055748-M09 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00055748-M09, RRID:AB_606076
- Product name
- CNDP2 monoclonal antibody (M09), clone 1B1
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant CNDP2.
- Antigen sequence
VCISDNYWLGKKKPCITYGLRGICYFFIEVECSNK
DLHSGVYGGSVHEAMTDLILLMGSLVDKRGNILIP
GINEAVAAVTEEEHKLYDDIDFDIEEFAKDVGAQI
LLHSH- Isotype
- IgG
- Antibody clone number
- 1B1
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references Laser microdissection and two-dimensional difference gel electrophoresis reveal the role of a novel macrophage-capping protein in lymph node metastasis in gastric cancer.
Proteomic profiling of the substantia nigra demonstrates CNDP2 overexpression in Parkinson's disease.
Ichikawa H, Kanda T, Kosugi S, Kawachi Y, Sasaki H, Wakai T, Kondo T
Journal of proteome research 2013 Aug 2;12(8):3780-91
Journal of proteome research 2013 Aug 2;12(8):3780-91
Proteomic profiling of the substantia nigra demonstrates CNDP2 overexpression in Parkinson's disease.
Licker V, Côte M, Lobrinus JA, Rodrigo N, Kövari E, Hochstrasser DF, Turck N, Sanchez JC, Burkhard PR
Journal of proteomics 2012 Aug 3;75(15):4656-67
Journal of proteomics 2012 Aug 3;75(15):4656-67
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of CNDP2 expression in transfected 293T cell line by CNDP2 monoclonal antibody (M09), clone 1B1.Lane 1: CNDP2 transfected lysate(52.9 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged CNDP2 is approximately 0.3ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol