H00055748-B01

CNDP2 antibody from Abnova Corporation
CN2, CPGL, FLJ10830, HsT2298, PEPA

Antibody data

Product number
H00055748-B01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00055748-B01, RRID:AB_1138088
Product name
CNDP2 MaxPab mouse polyclonal antibody (B01)
Provider product page
Abnova Corporation - H00055748-B01
Antibody type
Polyclonal
Description
Mouse polyclonal antibody raised against a full-length human CNDP2 protein.
Antigen sequence
MAALTTLFKYIDENQDRYIKKLAKWVAIQSVSAWP
EKRGEIRRMMEVAAADVKQLGGSVELVDIGKQKLP
DGSEIPLPPILLGRLGSDPQKKTVCIYGHLDVQPA
ALEDGWDSEPFTLVERDGKLYGRGSTDDKGPVAGW
INALEAYQKTGQEIPVNVRFCLEGMEESGSEGLDE
LIFARKDTFFKDVDYVCISDNYWLGKKKPCITYGL
RGICYFFIEVECSNKDLHSGVYGGSVHEAMTDLIL
LMGSLVDKRGNILIPGINEAVAAVTEEEHKLYDDI
DFDIEEFAKDVGAQILLHSHKKDILMHRWRYPSLS
LHGIEGAFSGSGAKTVIPRKVVGKFSIRLVPNMTP
EVVGEQVTSYLTKKFAELRSPNEFKVYMGHGGKPW
VSDFSHPHYLAGRRAMKTVFGVEPDLTREGGSIPV
TLTFQEATGKNVMLLPVGSADDGAHSQNEKLNRYN
YIEGTKMLAAYLYEVSQLKD
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -