HPA039083

MRPS31 antibody from Atlas Antibodies
IMOGN38
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA039083
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA039083, RRID:AB_2676340
Product name
Anti-MRPS31
Provider product page
Atlas Antibodies - HPA039083
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
QLATVNEQPLQNGFEELIQWTKEGKLWEFPINNEA
GFDDDGSEFHEHIFLEKHLESFPKQGPIRHFMELV
TCGLSKNPYLSVKQKVEH
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -