H00003821-M01A

KLRC1 antibody from Abnova Corporation
CD159a, NKG2, NKG2-A, NKG2-B

Antibody data

Product number
H00003821-M01A
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00003821-M01A, RRID:AB_1577706
Product name
KLRC1 monoclonal antibody (M01A), clone 2C3
Provider product page
Abnova Corporation - H00003821-M01A
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant KLRC1.
Antigen sequence
MDNQGVIYSDLNLPPNPKRQQRKPKGNKSSILATE
QEITYAELNLQKASQDFQGNDKTYHCKDLPSAPEK
Isotype
IgG
Antibody clone number
2C3
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -