HPA011948

SORCS1 antibody from Sigma-Aldrich
sorCS1
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011948
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011948, RRID:AB_1857366
Product name
Anti-SORCS1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011948
Antibody type
Polyclonal
Antigen
VPS10 domain-containing receptor SorCS1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
EWRRDIGRVIKKSLVEATGVPGQHILVAVLPGLPT
TAELFVLPYQDPAGENKRSTDDLEQISELLIHTLN
QNSVHFELKPGVRVLVHAAHLTAAPLVDLT
Storage
-20C
Provider Type Product Number
- No reagents -