HPA012739

PIGL antibody from Sigma-Aldrich
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA012739
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA012739, RRID:AB_1855367
Product name
Anti-PIGL antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA012739
Antibody type
Polyclonal
Antigen
N-acetylglucosaminyl-phosphatidylinositol de-N-acetylase recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MKSREQGGRLGAESRTLLVIAHPDDEAMFFAPTVL
GLARLRHWVYLLCFSAGNYYNQGETRKKELLQSCD
VLGIPLSSVMIIDNRDFPDDPGMQWDTEHVARVLL
QHIEVNGI
Storage
-20C
Provider Type Product Number
- No reagents -