Antibody data

Product number
H00009342-M05
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00009342-M05, RRID:AB_1137043
Product name
SNAP29 monoclonal antibody (M05), clone 1C10
Provider product page
Abnova Corporation - H00009342-M05
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a full-length recombinant SNAP29.
Antigen sequence
MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGP
DAPADRQQYLRQEVLRRAEATAASTSRSLALMYES
EKVGVASSEELARQRGVLERTEKMVDKMDQDLKIS
QKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTS
QPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDP
VPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELS
MGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLD
VNIKSTERKVRQL
Isotype
IgG
Antibody clone number
1C10
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -