HPA028255

ZNF407 antibody from Atlas Antibodies
FLJ13839, FLJ20307, KIAA1703
Eligible for validation within the Antibodypedia Validation Initiative

Antibody data

Product number
HPA028255
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA028255, RRID:AB_10603466
Product name
Anti-ZNF407
Provider product page
Atlas Antibodies - HPA028255
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
PVLGNKEILMNSQHETEFILEEDGPASDSTVESSD
VYETIISIDDKGQAMYSFGRFDSSIIRIKNPEDGE
LIDQSEEGLIATGVRISELPLKDCAQGVKKKKSEG
SSIGESTRIRCDDCGFL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -