HPA041673

ZNF407 antibody from Atlas Antibodies
FLJ13839, FLJ20307, KIAA1703

Antibody data

Product number
HPA041673
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA041673, RRID:AB_2677610
Product name
Anti-ZNF407
Provider product page
Atlas Antibodies - HPA041673
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
SRKLDTLVTSEGLLEKLESTKNTLQAAHGNSVTSR
PRPERNILVLGNSFRRRSSTFTLKGQAKKRFNLLG
IKRGTSETQRMYMKHLR
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Provider Type Product Number
- No reagents -