PAB22124

ZNF407 antibody from Abnova Corporation
FLJ13839, FLJ20307, KIAA1703

Antibody data

Product number
PAB22124
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB22124, RRID:AB_10984661
Product name
ZNF407 polyclonal antibody
Provider product page
Abnova Corporation - PAB22124
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant ZNF407.
Antigen sequence
PVLGNKEILMNSQHETEFILEEDGPASDSTVESSD
VYETIISIDDKGQAMYSFGRFDSSIIRIKNPEDGE
LIDQSEEGLIATGVRISELPLKDCAQGVKKKKSEG
SSIGESTRIRCDDCGFL
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -