ABIN567438

SNX18 antibody from antibodies-online
SH3PX2, SH3PXD3B, SNAG1

Antibody data

Product number
ABIN567438
Provider
antibodies-online
Product name
anti-Sorting Nexin 18 (SNX18) (C-Term) antibody
Provider product page
antibodies-online - ABIN567438
Antibody type
Polyclonal
Antigen
The immunogen for anti-SNAG1 antibody: synthetic peptide directed towards the C terminal of human SNAG1
Description
Affinity Purified
Reactivity
Human
Host
Rabbit
Antigen sequence
AIAFTGDAYDAIGELFAEQPRQDLDPVMDLLALYQ
GHLAN FPDIIHVQKG
Epitope
C-Term
Vial size
50 μg
Concentration
1mg/mL
Storage
-20°C
Handling
Avoid repeated freeze-thaw cycles.
Provider Type Product Number
- No reagents -