HPA011772

CNTNAP1 antibody from Sigma-Aldrich
Caspr, CNTNAP, NRXN4, p190
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA011772
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA011772, RRID:AB_1079541
Product name
Anti-CNTNAP1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA011772
Antibody type
Polyclonal
Antigen
Contactin-associated protein 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
MRLNGVTLNLEGRANASEGTSPNCTGHCAHPRLPC
FHGGRCVERYSYYTCDCDLTAFDGPYCNHDIGGFF
EPGTWMRYNLQSALRSAAREFSHMLSRPVPGYEPG
YIPGYDTPGY
Storage
-20C
Provider Type Product Number
- No reagents -