Antibody data

Product number
HPA042562
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA042562, RRID:AB_10964911
Product name
Anti-TBL3
Provider product page
Atlas Antibodies - HPA042562
Antibody type
Polyclonal
Reactivity
Human, Mouse, Rat
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
LWKDVTEAEQAEEQARQEEQVVRQQELDNLLHEKR
YLRALGLAISLDRPHTVLTVIQAIRRDPEACEKLE
ATMLRLRRDQKEALLRFCVTWNTNSRHCHEAQAVL
GVLL
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.