HPA055695

TBL3 antibody from Atlas Antibodies
SAZD, UTP13

Antibody data

Product number
HPA055695
Provider
Atlas Antibodies
Proper citation
Atlas Antibodies Cat#HPA055695, RRID:AB_2682888
Product name
Anti-TBL3
Provider product page
Atlas Antibodies - HPA055695
Antibody type
Polyclonal
Reactivity
Human
Host
Rabbit
Conjugate
Unconjugated
Antigen sequence
RFKTNYAVERKIEPFYKGGKAQLDQTGQHLFCVCG
TRVNILEVASGAVLRSLEQEDQEDITAFDLSPDNE
VLVTASRALLLAQWAWQEGSVTRLWKAIHTAPVAT
MAFDPTST
Isotype
IgG
Vial size
100 µl
Storage
Store at +4°C for short term storage. Long time storage is recommended at -20°C.