Antibody data
- Antibody Data
- Antigen structure
- References [3]
- Comments [0]
- Validations
- Western blot [1]
- ELISA [1]
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- H00011082-M02 - Provider product page

- Provider
- Abnova Corporation
- Proper citation
- Abnova Corporation Cat#H00011082-M02, RRID:AB_534859
- Product name
- ESM1 monoclonal antibody (M02), clone 6D4
- Antibody type
- Monoclonal
- Description
- Mouse monoclonal antibody raised against a partial recombinant ESM1.
- Antigen sequence
PSNGEDPFGEEFGICKDCPYGTFGMDCRETCNCQS
GICDRGTGKCLKFPFFQYSVTKSSNRFVSLTEHDM
ASGDGNIVREEVVKENAAGSPVMRKWLNPR- Isotype
- IgG
- Antibody clone number
- 6D4
- Storage
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Submitted references ESM-1 silencing decreased cell survival, migration, and invasion and modulated cell cycle progression in hepatocellular carcinoma.
Overexpression of endothelial cell specific molecule-1 (ESM-1) in gastric cancer.
Identification of endothelial cell-specific molecule-1 as a potential serum marker for colorectal cancer.
Kang YH, Ji NY, Lee CI, Lee HG, Kim JW, Yeom YI, Kim DG, Yoon SK, Kim JW, Park PJ, Song EY
Amino acids 2011 Mar;40(3):1003-13
Amino acids 2011 Mar;40(3):1003-13
Overexpression of endothelial cell specific molecule-1 (ESM-1) in gastric cancer.
Liu N, Zhang LH, Du H, Hu Y, Zhang GG, Wang XH, Li JY, Ji JF
Annals of surgical oncology 2010 Oct;17(10):2628-39
Annals of surgical oncology 2010 Oct;17(10):2628-39
Identification of endothelial cell-specific molecule-1 as a potential serum marker for colorectal cancer.
Ji NY, Kim YH, Jang YJ, Kang YH, Lee CI, Kim JW, Yeom YI, Chun HK, Choi YH, Kim JH, Kim JW, Lee HG, Song EY
Cancer science 2010 Oct;101(10):2248-53
Cancer science 2010 Oct;101(10):2248-53
No comments: Submit comment
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Western Blot analysis of ESM1 expression in transfected 293T cell line by ESM1 monoclonal antibody (M02), clone 6D4.Lane 1: ESM1 transfected lysate(20.1 KDa).Lane 2: Non-transfected lysate.
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Detection limit for recombinant GST tagged ESM1 is approximately 0.03ng/ml as a capture antibody.
- Validation comment
- Sandwich ELISA (Recombinant protein)
- Protocol
- Protocol
Supportive validation
- Submitted by
- Abnova Corporation (provider)
- Main image

- Experimental details
- Immunoperoxidase of monoclonal antibody to ESM1 on formalin-fixed paraffin-embedded human kidney. [antibody concentration 3 ug/ml]
- Validation comment
- Immunohistochemistry (Formalin/PFA-fixed paraffin-embedded sections)
- Protocol
- Protocol