Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations
- Immunohistochemistry [1]
Submit
Validation data
Reference
Comment
Report error
- Product number
- HPA030832 - Provider product page
- Provider
- Atlas Antibodies
- Proper citation
- Atlas Antibodies Cat#HPA030832, RRID:AB_10601869
- Product name
- Anti-MAPKBP1
- Antibody type
- Polyclonal
- Reactivity
- Human
- Host
- Rabbit
- Conjugate
- Unconjugated
- Antigen sequence
EKHSPDSACSVDYSSSCLSSPEHPTEDSESTEPLS
VDGISSDLEEPAEGDEEEEEEEGGMGPYGLQEGSP
QTPDQEQFLKQHFETLA- Isotype
- IgG
- Vial size
- 100 µl
- Storage
- Store at +4°C for short term storage. Long time storage is recommended at -20°C.
Submitted references The c-Jun N-terminal kinase (JNK)-binding protein (JNKBP1) acts as a negative regulator of NOD2 protein signaling by inhibiting its oligomerization process.
Lecat A, Di Valentin E, Somja J, Jourdan S, Fillet M, Kufer TA, Habraken Y, Sadzot C, Louis E, Delvenne P, Piette J, Legrand-Poels S
The Journal of biological chemistry 2012 Aug 24;287(35):29213-26
The Journal of biological chemistry 2012 Aug 24;287(35):29213-26
No comments: Submit comment
Supportive validation
- Submitted by
- Atlas Antibodies (provider)
- Main image
- Experimental details
- Immunohistochemical staining of human testis shows distinct cytoplasmic positivity in cells in seminiferous ducts.
- Sample type
- HUMAN