HPA007538

MLEC antibody from Sigma-Aldrich
KIAA0152
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007538
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007538, RRID:AB_1079188
Product name
Anti-MLEC antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007538
Antibody type
Polyclonal
Antigen
Malectin Precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
VKDLDIFDRVGHSTAHDEIIPMSIRKGKLSVQGEV
STFTGKLYIEFVKGYYDNPKVCALYIMAGTVDDVP
KLQPHPGLEKKEEEEEEEEYDEGSNLKKQTNKNRV
Q
Storage
-20C
Provider Type Product Number
- No reagents -