HPA029348

TMEM156 antibody from MilliporeSigma / Merck KGaA
FLJ23235
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA029348
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA029348, RRID:AB_10602247
Product name
Anti-TMEM156 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA029348
Antibody type
Polyclonal
Antigen
transmembrane protein 156 recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
QSNFTYSLSSLNFSFVTFLQPVRETQIIMRIFLNP
SNFRNFTRTCQDITGEFKMCSSCLVCEPKGNMDFI
SQEQTSKVLIRRGSMEVKANDFHSPCQHFNFSVAP
LVDHLEEYNTTCH
Storage
-20C
Provider Type Product Number
- No reagents -