HPA007955

MANSC1 antibody from Sigma-Aldrich
FLJ10298, LOH12CR3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007955
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#HPA007955, RRID:AB_1079306
Product name
Anti-MANSC1 antibody produced in rabbit
Provider product page
Sigma-Aldrich - HPA007955
Antibody type
Polyclonal
Antigen
MANSC domain-containing protein 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
NISGDKACNLMIFDTRKTARQPNCYLFFCPNEEAC
PLKPAKGLMSYRIITDFPSLTRNLPSQELPQEDSL
LHGQFSQAVTPLAHHHTDYSKPTDISWRDTLSQKF
GSSDHLEKLFKMDEASAQLLAYKEKGHSQSSQFSS
D
Storage
-20C
Provider Type Product Number
- No reagents -