HPA007956

MANSC1 antibody from MilliporeSigma / Merck KGaA
FLJ10298, LOH12CR3
Immunohistochemistry
Recommended by provider
Protein array
Recommended by provider

Antibody data

Product number
HPA007956
Provider
MilliporeSigma / Merck KGaA
Proper citation
Sigma-Aldrich Cat#HPA007956, RRID:AB_1079305
Product name
Anti-MANSC1 antibody produced in rabbit
Provider product page
MilliporeSigma / Merck KGaA - HPA007956
Antibody type
Polyclonal
Antigen
MANSC domain-containing protein 1 precursor recombinant protein epitope signature tag (PrEST)
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
TLLPTNASVTPSGTSQPQLATTAPPVTTVTSQPPT
TLISTVFTRAAATLQAMATTAVLTTTFQAPTDSKG
SLETIPFTEISNLTLNTGNVYNPTALSMSNVESST
MNKTASWEGREASPGSSSQGSVPENQYG
Storage
-20C
Provider Type Product Number
- No reagents -