Antibody data

Product number
H00000293-M01
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#H00000293-M01, RRID:AB_530198
Product name
SLC25A6 monoclonal antibody (M01), clone 2A9
Provider product page
Abnova Corporation - H00000293-M01
Antibody type
Monoclonal
Description
Mouse monoclonal antibody raised against a partial recombinant SLC25A6.
Antigen sequence
DFARTRLAADVGKSGTEREFRGLGDCLVKITKSDG
IRGLYQGFSVSVQGIIIYRAAYFGVYDTAKGMLPD
PKNTH
Isotype
IgG
Antibody clone number
2A9
Storage
Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -