Antibody data
- Antibody Data
- Antigen structure
- References [1]
- Comments [0]
- Validations [0]
Submit
Validation data
Reference
Comment
Report error
- Product number
- ABIN406707 - Provider product page
- Provider
- antibodies-online
- Product name
- anti-Solute Carrier Family 25 (Mitochondrial Carrier, Adenine Nucleotide Translocator), Member 6 (SLC25A6) (N-Term) antibody
- Antibody type
- Polyclonal
- Antigen
- The immunogen for anti-SLC25A6 antibody: synthetic peptide directed towards the N terminal of human SLC25A6
- Description
- Affinity Purified
- Reactivity
- Human, Mouse, Rat, Bovine, Chicken/Avian
- Host
- Rabbit
- Antigen sequence
LQVQHASKQIAADKQYKGIVDCIVRIPKEQGVLSF
WRGNL ANVIRYFPTQ- Epitope
- N-Term
- Vial size
- 50 μg
- Concentration
- 1mg/mL
- Storage
- -20°C
- Handling
- Avoid repeated freeze-thaw cycles.
Submitted references Adenine nucleotide (ADP/ATP) translocase 3 participates in the tumor necrosis factor induced apoptosis of MCF-7 cells.
Yang Z, Cheng W, Hong L, Chen W, Wang Y, Lin S, Han J, Zhou H, Gu J
Molecular biology of the cell 2007 Nov;18(11):4681-9
Molecular biology of the cell 2007 Nov;18(11):4681-9
No comments: Submit comment
No validations: Submit validation data