SAB2102191

SLC25A6 antibody from Sigma-Aldrich
ANT3, ANT3Y, MGC17525
No application information provided.

Antibody data

Product number
SAB2102191
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#SAB2102191, RRID:AB_10605305
Product name
Anti-SLC25A6 antibody produced in rabbit
Provider product page
Sigma-Aldrich - SAB2102191
Antibody type
Polyclonal
Antigen
Peptide region of the protein sequence according to NP_001627.
Description
affinity isolated antibody
Reactivity
Human
Antigen sequence
LQVQHASKQIAADKQYKGIVDCIVRIPKEQGVLSF
WRGNLANVIRYFPTQ
Storage
-20C
Provider Type Product Number
- No reagents -