WH0000293M1

SLC25A6 antibody from Sigma-Aldrich
ANT3, ANT3Y, MGC17525
ELISA
Recommended by provider

Antibody data

Product number
WH0000293M1
Provider
Sigma-Aldrich
Proper citation
Sigma-Aldrich Cat#WH0000293M1, RRID:AB_1843625
Product name
Monoclonal Anti-SLC25A6 antibody produced in mouse
Provider product page
Sigma-Aldrich - WH0000293M1
Antibody type
Monoclonal
Antigen
SLC25A6 (NP_001627, a.a. 135-210) partial recombinant protein with GST tag. MW of the GST tag alone is 26 kDa.
Description
purified immunoglobulin
Reactivity
Human
Antigen sequence
DFARTRLAADVGKSGTEREFRGLGDCLVKITKSDG
IRGLYQGFSVSVQGIIIYRAAYFGVYDTAKGMLPD
PKNTH* (without GST)
Isotype
IgG
Storage
-20C
Provider Type Product Number
- No reagents -