PAB19998

GRK3 antibody from Abnova Corporation
ADRBK2, BARK2

Antibody data

Product number
PAB19998
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB19998, RRID:AB_10965854
Product name
ADRBK2 polyclonal antibody
Provider product page
Abnova Corporation - PAB19998
Antibody type
Polyclonal
Description
Rabbit polyclonal antibody raised against recombinant ADRBK2.
Antigen sequence
YEAVNADTDKIEARKRAKNKQLGHEEDYALGKDCI
MHGYMLKLGNPFLTQWQRRYFYLFPNRLEWRGEGE
SRQNLLTMEQILSVEETQIKDKKCILFRIKGGKQF
VLQCESDPEFVQWKKELNETFKEAQRLLRRAPKFL
NKPRS
Isotype
IgG
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -