Antibody data

Product number
ABIN635537
Provider
antibodies-online
Product name
anti-SAYSVFN Motif Domain Containing 1 (SAYSD1) (C-Term) antibody
Provider product page
antibodies-online - ABIN635537
Antibody type
Polyclonal
Antigen
C6 ORF64 antibody was raised using the C terminal Of C6 rf64 corresponding to a region with amino acids MYVGTRGPEEKKEGEKSAYSVFNPGCEAIQGTLTAEQLERELQLRPLAGR
Description
Affinity purified
Reactivity
Human, Rat
Host
Rabbit
Epitope
C-Term
Vial size
50 μg
Concentration
1 mg/mL
Storage
Store at 2-8°C for short periods. For longer periods of storage, store at -20°C.
Handling
Avoid repeated freeze/thaw cycles. Dilute only prior to immediate use.
Provider Type Product Number
- No reagents -