Antibody data

Product number
PAB20402
Provider
Abnova Corporation
Proper citation
Abnova Corporation Cat#PAB20402, RRID:AB_10966300
Product name
SAYSD1 polyclonal antibody
Provider product page
Abnova Corporation - PAB20402
Antibody type
Polyclonal
Antigen
Recombinant protein corresponding to amino acids of human SAYSD1.
Reactivity
Human, Mouse, Rat
Host
Rabbit
Antigen sequence
LFYWMYVGTRGPEEKKEGEKSAYSVFNPGCEAIQG
TLTAEQLERELQLRPLA
Isotype
IgG
Vial size
100 µl
Storage
Store at 4°C. For long term storage store at -20°C.Aliquot to avoid repeated freezing and thawing.
Provider Type Product Number
- No reagents -